Банк рефератов содержит более 364 тысяч рефератов, курсовых и дипломных работ, шпаргалок и докладов по различным дисциплинам: истории, психологии, экономике, менеджменту, философии, праву, экологии. А также изложения, сочинения по литературе, отчеты по практике, топики по английскому.
Полнотекстовый поиск
Всего работ:
364150
Теги названий
Разделы
Авиация и космонавтика (304)
Административное право (123)
Арбитражный процесс (23)
Архитектура (113)
Астрология (4)
Астрономия (4814)
Банковское дело (5227)
Безопасность жизнедеятельности (2616)
Биографии (3423)
Биология (4214)
Биология и химия (1518)
Биржевое дело (68)
Ботаника и сельское хоз-во (2836)
Бухгалтерский учет и аудит (8269)
Валютные отношения (50)
Ветеринария (50)
Военная кафедра (762)
ГДЗ (2)
География (5275)
Геодезия (30)
Геология (1222)
Геополитика (43)
Государство и право (20403)
Гражданское право и процесс (465)
Делопроизводство (19)
Деньги и кредит (108)
ЕГЭ (173)
Естествознание (96)
Журналистика (899)
ЗНО (54)
Зоология (34)
Издательское дело и полиграфия (476)
Инвестиции (106)
Иностранный язык (62792)
Информатика (3562)
Информатика, программирование (6444)
Исторические личности (2165)
История (21320)
История техники (766)
Кибернетика (64)
Коммуникации и связь (3145)
Компьютерные науки (60)
Косметология (17)
Краеведение и этнография (588)
Краткое содержание произведений (1000)
Криминалистика (106)
Криминология (48)
Криптология (3)
Кулинария (1167)
Культура и искусство (8485)
Культурология (537)
Литература : зарубежная (2044)
Литература и русский язык (11657)
Логика (532)
Логистика (21)
Маркетинг (7985)
Математика (3721)
Медицина, здоровье (10549)
Медицинские науки (88)
Международное публичное право (58)
Международное частное право (36)
Международные отношения (2257)
Менеджмент (12491)
Металлургия (91)
Москвоведение (797)
Музыка (1338)
Муниципальное право (24)
Налоги, налогообложение (214)
Наука и техника (1141)
Начертательная геометрия (3)
Оккультизм и уфология (8)
Остальные рефераты (21697)
Педагогика (7850)
Политология (3801)
Право (682)
Право, юриспруденция (2881)
Предпринимательство (475)
Прикладные науки (1)
Промышленность, производство (7100)
Психология (8694)
психология, педагогика (4121)
Радиоэлектроника (443)
Реклама (952)
Религия и мифология (2967)
Риторика (23)
Сексология (748)
Социология (4876)
Статистика (95)
Страхование (107)
Строительные науки (7)
Строительство (2004)
Схемотехника (15)
Таможенная система (663)
Теория государства и права (240)
Теория организации (39)
Теплотехника (25)
Технология (624)
Товароведение (16)
Транспорт (2652)
Трудовое право (136)
Туризм (90)
Уголовное право и процесс (406)
Управление (95)
Управленческие науки (24)
Физика (3463)
Физкультура и спорт (4482)
Философия (7216)
Финансовые науки (4592)
Финансы (5386)
Фотография (3)
Химия (2244)
Хозяйственное право (23)
Цифровые устройства (29)
Экологическое право (35)
Экология (4517)
Экономика (20645)
Экономико-математическое моделирование (666)
Экономическая география (119)
Экономическая теория (2573)
Этика (889)
Юриспруденция (288)
Языковедение (148)
Языкознание, филология (1140)

Статья: Наследование групп крови резус

Название: Наследование групп крови резус
Раздел: Биология и химия
Тип: статья Добавлен 04:48:09 05 декабря 2007 Похожие работы
Просмотров: 778 Комментариев: 2 Оценило: 2 человек Средний балл: 4 Оценка: неизвестно     Скачать

На рисунке представлено положение резус белка резус в мембране эритроцитов.

Почему он так назван? В 30-40-х годах, когда довольно интенсивно проводились исследования групп крови, было обнаружено, что антитела к группе крови мартышки резус агглютинируют у некоторых людей их эритроциты.

Агглютинация – это процесс склеивания эритроцитов под действием антител к белам, расположенным на мембранах эритроцитов. На рисунке ниже представлен картина агглютинации. Здесь изображены капельки крови , к которым добавлена сыворотка, содержащая антитела к резус-белку. Синим обведены капли, в которых с кровью ничего не происходит. Если реакция при добавлении антител не идет, то, значит у данного человека резус-белок отсутствует. Красным обведены образцы крови, в которых происходит агглютинация. Буквами помечены капли крови, которые реакцию дают, но очень слабую. Такое встречается у приблизительно 1% людей, и это так и называемый слабый резус фенотип.

С чем это связано? На рисунке ниже буквами представлена последовательность резус-белка. Вы знаете, что белок состоит из 20 аминокислот, каждая из которых обозначается своей буквой. Ген (последовательность нуклеотидов, соответственно, в 3 раза более длинная последовательность, записанная только четыремя буквами, а не 20), который кодирует резус-белок, называется RHD.

АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА

(каждая аминокислота обозначена одной буквой):

Информация из базы данных NCBI

Human RhD blood group antigen mRNA, complete cds

ORGANISM Homo sapiens

standard_name="RhD"

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

KYFDDQVFWKFPHLAVGF

ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА

Информация из базы данных NCBI

1 atgagctcta agtacccgcg gtctgtccgg cgctgcctgc ccctctgggc cctaacactg
61 gaagcagctc tcattctcct cttctatttt tttacccact atgacgcttc cttagaggat
121 caaaaggggc tcgtggcatc ctatcaagtt ggccaagatc tgaccgtgat ggcggccatt
181 ggcttgggct tcctcacctc gagtttccgg agacacagct ggagcagtgt ggccttcaac
241 ctcttcatgc tggcgcttgg tgtgcagtgg gcaatcctgc tggacggctt cctgagccag
301 ttcccttctg ggaaggtggt catcacactg ttcagtattc ggctggccac catgagtgct
361 ttgtcggtgc tgatctcagt ggatgctgtc ttggggaagg tcaacttggc gcagttggtg
421 gtgatggtgc tggtggaggt gacagcttta ggcaacctga ggatggtcat cagtaatatc
481 ttcaacacag actaccacat gaacatgatg cacatctacg tgttcgcagc ctattttggg
541 ctgtctgtgg cctggtgcct gccaaagcct ctacccgagg gaacggagga taaagatcag
601 acagcaacga tacccagttt gtctgccatg ctgggcgccc tcttcttgtg gatgttctgg
661 ccaagtttca actctgctct gctgagaagt ccaatcgaaa ggaagaatgc cgtgttcaac
721 acctactatg ctgtagcagt cagcgtggtg acagccatct cagggtcatc cttggctcac
781 ccccaaggga agatcagcaa gacttatgtg cacagtgcgg tgttggcagg aggcgtggct
841 gtgggtacct cgtgtcacct gatcccttct ccgtggcttg ccatggtgct gggtcttgtg
901 gctgggctga tctccgtcgg gggagccaag tacctgccgg ggtgttgtaa ccgagtgctg
961 gggattcccc acagctccat catgggctac aacttcagct tgctgggtct gcttggagag
1021 atcatctaca ttgtgttgct ggtgcttgat accgtcggag ccggcaatgg catgattggc
1081 ttccaggtcc tcctcagcat tggggaactc agcttggcca tcgtgatagc tctcacgtct
1141 ggtctcctga caggtttgct cctaaatctt aaaatatgga aagcacctca tgaggctaaa
1201 tattttgatg accaagtttt ctggaagttt cctcatttgg ctgttggatt ttaagcaaaa
1261 gcatccaaga aaaacaaggc ctgttcaaaa acaagacaac ttcctctcac tgttgcctgc
1321 atttgtacgt gagaaacgct catgacagca aagt//

У большинства людей (85%) имеется ген резус-фактора, но у 15% этот ген отсутствует, отсутствует соответствующий гену нуклеотидный "текст" . Если этот ген присутствует, то он определяет у человека синтез резус-белка. Если же его нет, то резус-белок не синтезируется.

Такие разные "состояния" гена – вариации нуклеотидного "текста" называются альтернативными формами или коротко –аллелями. В данном случае вариация – это наличие или отсутствие всей нуклеотидной последовательности гена.

У человека может встречаться 3 варианта сочетания резус-аллелей. Человек, у которого 2 аллеля с присутствующим геном, имеет группу крови резус положительную (рис. 4 вверху). Если у человека на одной из хромосом ген отсутствует, то белок все равно синтезируется с гена на другой хромосоме; и резус-группа также положительная (рис. в середине). Белок не синтезируется только в том случае, когда ген отсутствует на обоих хромосомах. Только в этом случае группа крови резус-отрицательная (рис. 4 внизу).

Вопрос, который был задан, описывал ситуацию, когда оба родителя имеют два разных аллеля. То есть оба они резус-положительны, но второй аллель у них не содержит последовательность, кодирующую резус-белок. И оба их ребенка получили от каждого из родителей как раз этот аллель с отсутствующим геном. Несложно рассчитать вероятность рождения в такой семье ребенка с отрицательным резус-фактором. Она равна 25% (1/2*1/2=1/4); вероятность же рождения обоих детей с резус-отрицательной группой крови – 1/16.

Стоит упомянуть о резус-конфликте. Его суть заключается в следующем. Если мать резус-отрицательна, ее муж резус-положительный, и ребенок наследует от отца Rh+, то в крови матери могут начать вырабатываться антитела против резус-фактора плода. При первой беременности этого обычно не происходит, но при родах возможен контакт с белками крови ребенка, и у матери могут появиться в крови антитела к резус-фактору. Тогда при следующей беременности резус-положительным плодом материнские антитела разрушат эритроциты ребенка. Это заболевание называется гемолитическая желтуха (ребенок рождается весь желтый и обычно вскоре умирает). Описано это заболевание впервые в 1609 году французской акушеркой. Когда была разработана процедура переливания крови, то таких детей научились спасать. Им делали заменное переливание крови, т.е. полностью сливали всю их кровь, и вводили новую. Теперь, когда установлены причины резус-конфликта, поступают следующим образом. Если во время беременности, у женщины кровь резус-отрицательна, а у мужа резус-положительна, следят за уровнем антител к резус-фактору и проводят необходимое лечение, если титр этих антител начинает возрастать. Стоит отметить, что если мать резус-положительна, а сам ребенок резус-отрицателен, то конфликта не происходит.

Я бы хотела отметить один из полученных ответов на этот вопрос. Когда мы составляли вопросы для лекций, мы получили реальный вопрос из газеты «АиФ» с просьбой разъяснить, в чем дело. Мы решили включить этот вопрос в опросник, с целью проверить, насколько наши слушателе знакомы с генетикой. Собственно, вопрос предполагался как чисто учебный. И вот один из ответов был следующим: «Я бы не рискнул отвечать на этот вопрос, так как я не специалист, а от моего ответа зависит семейное счастье человека». Хочется выразить уважение человеку, который так ответил на вопрос, потому что он воспринял контекст, в котором стояла чисто учебная задача. Он продемонстрировал понимание этических аспектов, связанных с наукой. Я думаю, вы понимаете, что существует ответственность ученого, и замечательно, что в вашей аудитории есть люди, которые уже сейчас настолько ясно понимают связь науки с реальной жизнью.

Оценить/Добавить комментарий
Имя
Оценка
Комментарии:
Где скачать еще рефератов? Здесь: letsdoit777.blogspot.com
Евгений22:22:07 18 марта 2016
Кто еще хочет зарабатывать от 9000 рублей в день "Чистых Денег"? Узнайте как: business1777.blogspot.com ! Cпециально для студентов!
15:44:27 24 ноября 2015

Работы, похожие на Статья: Наследование групп крови резус

Назад
Меню
Главная
Рефераты
Благодарности
Опрос
Станете ли вы заказывать работу за деньги, если не найдете ее в Интернете?

Да, в любом случае.
Да, но только в случае крайней необходимости.
Возможно, в зависимости от цены.
Нет, напишу его сам.
Нет, забью.



Результаты(151072)
Комментарии (1843)
Copyright © 2005-2016 BestReferat.ru bestreferat@mail.ru       реклама на сайте

Рейтинг@Mail.ru